PDB entry 4zot

View 4zot on RCSB PDB site
Description: Crystal structure of BbKI, a disulfide-free plasma kallikrein inhibitor at 1.4 A resolution
Class: protein binding
Keywords: kallikrein inhibitor, Kunitz-type kallikrein inhibitor, PROTEIN BINDING
Deposited on 2015-05-06, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz-type serine protease inhibitor BbKI
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83052 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d4zota1, d4zota2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zotA (A:)
    sghssvvvdtngqpvsngadayylvpvshghaglalakigneaepravvldphhrpglpv
    rfesplriniikesyflnikfgpsssdsgvwdviqqdpiglavkvtdtksllgpfkveke
    gegykivyypergqtgldiglvhrndkyylavkdgepcvfkirkatde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zotA (A:)
    ssvvvdtngqpvsngadayylvpvshghaglalakigneaepravvldphhrpglpvrfe
    splriniikesyflnikfgpsssdsgvwdviqqdpiglavkvtdtksllgpfkvekegeg
    ykivyypergqtgldiglvhrndkyylavkdgepcvfkirkat