PDB entry 4zoh

View 4zoh on RCSB PDB site
Description: Crystal structure of glyceraldehyde oxidoreductase
Class: oxidoreductase
Keywords: xanthine oxidoreductase family, molybdopterin cofactor, flavin adenine dinucleotide, iron-sulfur cluster, OXIDOREDUCTASE
Deposited on 2015-05-06, released 2016-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase molybdopterin-binding subunit
    Species: Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative oxidoreductase FAD-binding subunit
    Species: Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zohb1, d4zohb2
  • Chain 'C':
    Compound: Putative oxidoreductase iron-sulfur subunit
    Species: Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zohc1, d4zohc2
  • Heterogens: MCN, MO, 1PE, PEG, FAD, PG4, ACY, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zohB (B:)
    myppkfgyvipdnlnealefleehqdarplagghslipmlklrlirpsyiveirrfsnls
    yitkdgnlykigaltthyniskssipllsetasnigdpqvrnmgtiggsishldpsadyp
    aaliamdakvkitsrkgdrvvnfksfakdmftpdlnpgelvteiqvptfegykfsyqkle
    rragdfaivgvalllklsgdviedvrigltavnnvavrakgaeeellgkrlndeiiekaa
    tramesanptsdlrgsaeykkkmvkvltkraiitalkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zohB (B:)
    myppkfgyvipdnlnealefleehqdarplagghslipmlklrlirpsyiveirrfsnls
    yitkdgnlykigaltthyniskssipllsetasnigdpqvrnmgtiggsishldpsadyp
    aaliamdakvkitsrkgdrvvnfksfakdmftpdlnpgelvteiqvptfegykfsyqkle
    rragdfaivgvalllklsgdviedvrigltavnnvavrakgaeeellgkrlndeiiekaa
    tramesanptsgsaeykkkmvkvltkraiitalk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zohC (C:)
    mkiinsdqkvkitlkingekyeteveprrllvhvlrelgftgvhigcdtsncgactvimn
    gksvksctvlaveadgaeiltveglakdgklhpiqeafwenhalqcgyctpgmimeaywl
    lrekpnpteeeiregisgnlcrctgyqnivkaikaaaeklsqtpyqhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zohC (C:)
    mkiinsdqkvkitlkingekyeteveprrllvhvlrelgftgvhigcdtsncgactvimn
    gksvksctvlaveadgaeiltveglakdgklhpiqeafwenhalqcgyctpgmimeaywl
    lrekpnpteeeiregisgnlcrctgyqnivkaikaaaekls