PDB entry 4zo4

View 4zo4 on RCSB PDB site
Description: Dephospho-CoA kinase from Campylobacter jejuni.
Class: transferase
Keywords: structural genomics, IDP00325, dephospho-CoA kinase, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2015-05-06, released 2015-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) [TaxId:192222]
    Gene: coaE, Cj1530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PMD9 (4-203)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4zo4a1, d4zo4a2
  • Chain 'B':
    Compound: dephospho-coa kinase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) [TaxId:192222]
    Gene: coaE, Cj1530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PMD9 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4zo4b1, d4zo4b2
  • Chain 'C':
    Compound: dephospho-coa kinase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) [TaxId:192222]
    Gene: coaE, Cj1530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PMD9 (4-203)
      • expression tag (3)
    Domains in SCOPe 2.06: d4zo4c1, d4zo4c2
  • Chain 'D':
    Compound: dephospho-coa kinase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) [TaxId:192222]
    Gene: coaE, Cj1530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PMD9 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.06: d4zo4d1, d4zo4d2
  • Heterogens: BME

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zo4A (A:)
    snamknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslk
    nllkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveipl
    ffesgayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiik
    ntnsyadfrqecvkviqeiskgnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zo4A (A:)
    amknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknl
    lkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplff
    esgayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiiknt
    nsyadfrqecvkviqeiskgnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zo4B (B:)
    snamknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslk
    nllkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveipl
    ffesgayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiik
    ntnsyadfrqecvkviqeiskgnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zo4B (B:)
    amknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknl
    lkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplfe
    nlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntnsyadf
    rqecvkviqeiskg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zo4C (C:)
    snamknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslk
    nllkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveipl
    ffesgayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiik
    ntnsyadfrqecvkviqeiskgnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zo4C (C:)
    mknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknll
    kkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplffe
    sgayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntn
    syadfrqecvkviqeiskgnm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zo4D (D:)
    snamknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslk
    nllkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveipl
    ffesgayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiik
    ntnsyadfrqecvkviqeiskgnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zo4D (D:)
    amknaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknl
    lkkekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplfe
    nlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntnsyadf
    rqecvkviqeiskg