PDB entry 4zo3

View 4zo3 on RCSB PDB site
Description: AidC, a Dizinc Quorum-Quenching Lactonase, in complex with a product N-hexnoyl-L-homoserine
Class: hydrolase
Keywords: Quorum-quenching, N-acyl-L-homoserine, lactonase, dizinc, AidC, HYDROLASE
Deposited on 2015-05-05, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylhomoserine lactonase
    Species: Chryseobacterium sp. StRB126 [TaxId:878220]
    Gene: aidC, CHSO_3121
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zo3a_
  • Chain 'B':
    Compound: Acylhomoserine lactonase
    Species: Chryseobacterium sp. StRB126 [TaxId:878220]
    Gene: aidC, CHSO_3121
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zo3b_
  • Heterogens: ZN, C6L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zo3A (A:)
    ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain
    illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd
    kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl
    kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg
    dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zo3B (B:)
    ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain
    illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd
    kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl
    kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg
    dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn