PDB entry 4zo2

View 4zo2 on RCSB PDB site
Description: AidC, a Dizinc Quorum-Quenching Lactonase
Class: hydrolase
Keywords: Quorum-quenching, N-acyl-L-homoserine lactone, lactonase, dizinc, HYDROLASE
Deposited on 2015-05-05, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylhomoserine lactonase
    Species: Chryseobacterium sp. StRB126 [TaxId:878220]
    Gene: aidC, CHSO_3121
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zo2a_
  • Chain 'B':
    Compound: Acylhomoserine lactonase
    Species: Chryseobacterium sp. StRB126 [TaxId:878220]
    Gene: aidC, CHSO_3121
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zo2b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zo2A (A:)
    ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain
    illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd
    kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl
    kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg
    dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zo2A (A:)
    dlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmaini
    llvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvdk
    qnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpklk
    fydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsgd
    tdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zo2B (B:)
    ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain
    illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd
    kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl
    kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg
    dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn