PDB entry 4znz

View 4znz on RCSB PDB site
Description: Crystal structure of Escherichia coli carbonic anhydrase (YadF) in complex with Zn - artifact of purification
Class: lyase
Keywords: carbonic anhydrase, YadF, crystallization artifact, zinc binding, LYASE
Deposited on 2015-05-05, released 2015-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Escherichia coli [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4znza_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4znzA (A:)
    mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgel
    fvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwl
    lhirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwa
    ygihdgllrdldvtatnretleqryrhgisnlklkhanhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4znzA (A:)
    kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
    vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
    hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
    gihdgllrdldvtatnretleqryrhgisnlklkh