PDB entry 4zne

View 4zne on RCSB PDB site
Description: IgG1 Fc-FcgammaRI ecd complex
Class: immune system
Keywords: Antibody, constant region, receptor, high affinity, IMMUNE SYSTEM
Deposited on 2015-05-04, released 2015-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity immunoglobulin gamma Fc receptor I
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR1A, FCG1, FCGR1, IGFR1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4znee1, d4znee2
  • Chain 'J':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4znej1, d4znej2
  • Heterogens: NAG, MAN, ZN, FUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zneE (E:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zneE (E:)
    pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp
    reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytl
    ppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslslspg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4zneJ (J:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zneJ (J:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls