PDB entry 4znc

View 4znc on RCSB PDB site
Description: Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant - Q9W
Class: protein binding
Keywords: Staphylococcal protein A, SpA, three-helix-bundle, antibody, IgG, protein-binding domain, PROTEIN BINDING
Deposited on 2015-05-04, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507
      • engineered mutation (8)
    Domains in SCOPe 2.07: d4znca_
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507
      • engineered mutation (8)
    Domains in SCOPe 2.07: d4zncb_
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507
      • engineered mutation (8)
    Domains in SCOPe 2.07: d4zncc_
  • Chain 'D':
    Compound: Ig gamma-3 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01860 (0-End)
      • conflict (58)
      • conflict (197-198)
    Domains in SCOPe 2.07: d4zncd1, d4zncd2
  • Chain 'E':
    Compound: Ig gamma-3 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01860 (0-End)
      • conflict (58)
      • conflict (197-198)
    Domains in SCOPe 2.07: d4znce1, d4znce2
  • Chain 'F':
    Compound: Ig gamma-3 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01860
      • conflict (197-198)
    Domains in SCOPe 2.07: d4zncf1, d4zncf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zncA (A:)
    adnkfnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zncA (A:)
    fnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zncB (B:)
    adnkfnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zncB (B:)
    fnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zncC (C:)
    adnkfnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zncC (C:)
    fnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zncD (D:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfn
    stfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksrw
    qqgnifscsvmhealhnhytqkslslspgkgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zncD (D:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfn
    stfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksrw
    qqgnifscsvmhealhnhytqkslsls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zncE (E:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfn
    stfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksrw
    qqgnifscsvmhealhnhytqkslslspgkgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zncE (E:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfn
    stfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksrw
    qqgnifscsvmhealhnhytqkslsls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zncF (F:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqfn
    stfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksrw
    qqgnifscsvmhealhnhytqkslslspgkgslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zncF (F:)
    vflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpvvsvltvl
    hqdwlngkeykckvsnkalpapiektisktkgqprepqvytlppsreemtknqvsltclv
    kgfypsdiavewessgqpennynttppmldsdgsfflyskltvdksrwqqgnifscsvmh
    ealhnhytqkslsls