PDB entry 4zn1

View 4zn1 on RCSB PDB site
Description: Crystal Structure of MjSpt4:Spt5 complex conformation A
Class: transcription
Keywords: protein-protein complex, TRANSCRIPTION
Deposited on 2015-05-04, released 2016-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation factor SPT5
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Gene: spt5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription elongation factor SPT4
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Gene: spt4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57839 (14-71)
      • expression tag (13)
    Domains in SCOPe 2.08: d4zn1b1, d4zn1b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4zn1B (B:)
mgsshhhhhhsqdpraclkckyltndeicpichsptsenwigllivinpekseiakkagi
dikgkyalsvke

    Sequence, based on observed residues (ATOM records): (download) 
    >4zn1B (B:)
praclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke