PDB entry 4zmz

View 4zmz on RCSB PDB site
Description: Crystal structure of human P-cadherin (monomer 2)
Class: cell adhesion
Keywords: dimerization, conformational change, CELL ADHESION
Deposited on 2015-05-04, released 2016-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: Cdh3, Cdhp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zmza1, d4zmza2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zmzA (A:)
rdwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgw
lllnkpldreeiakyelfghavsengasvedpmnisiivtdqndhkpkftqdtfrgsvle
gvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdlmftihrstgtisvissgl
drekvpeytltiqatdmdgdgstttavavveild