PDB entry 4zm4

View 4zm4 on RCSB PDB site
Description: Complex structure of PctV K276R mutant with PMP and 3-dehydroshkimate
Class: transferase
Keywords: pyridoxal 5-phosphate, Aminotransferase, TRANSFERASE
Deposited on 2015-05-02, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8R0K5
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4zm4a_
  • Chain 'B':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8R0K5
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4zm4b_
  • Chain 'C':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8R0K5
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4zm4c_
  • Chain 'D':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8R0K5
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4zm4d_
  • Chain 'E':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8R0K5
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4zm4e_
  • Chain 'F':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8R0K5
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4zm4f_
  • Heterogens: PLP, P3B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zm4A (A:)
    gshmgandadrptnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgei
    idlnmgygphlfgyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfa
    nsgteavasalrlarattgrtlvvtfeghyhgwsetvlragktalhmegtrptdvvpgal
    gmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvippapgflqllrel
    tgrsgamlvfdevitgfrvarggaqerygvepdltvlsrvmgggfpvaafggrrhamrml
    asneahhagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrpv
    hinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalep
    wflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm4A (A:)
    tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgeiidlnmgygphlf
    gyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfansgteavasalr
    larattgrtlvvtfeghyhgwsetvlragrptdvvpgalgmipealahtvqlgwndpdal
    relfardgdriaavivepvlanagvippapgflqllreltgrsgamlvfdevitgfrvar
    ggaqerygvepdltvlsrvmgggfpvaafggrrhamrmlasneahhagvyagnhaalrav
    vamlgkirslpdlyerledtgqymedtvrevfatekrpvhinrvgtlmsvallkeprdlr
    qlaalvdfprhrrlqtlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zm4B (B:)
    gshmgandadrptnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgei
    idlnmgygphlfgyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfa
    nsgteavasalrlarattgrtlvvtfeghyhgwsetvlragktalhmegtrptdvvpgal
    gmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvippapgflqllrel
    tgrsgamlvfdevitgfrvarggaqerygvepdltvlsrvmgggfpvaafggrrhamrml
    asneahhagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrpv
    hinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalep
    wflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm4B (B:)
    tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgeiidlnmgygphlf
    gyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfansgteavasalr
    larattgrtlvvtfeghyhgwsetvlratrptdvvpgalgmipealahtvqlgwndpdal
    relfardgdriaavivepvlanagvippapgflqllreltgrsgamlvfdevitgfrvar
    ggaqerygvepdltvlsrvmgggfpvaafggrrhamrmlasneahhagvyagnhaalrav
    vamlgkirslpdlyerledtgqymedtvrevfatekrpvhinrvgtlmsvallkgsaeps
    aeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalepwflstahtrdvidkvagalqr
    slvgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zm4C (C:)
    gshmgandadrptnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgei
    idlnmgygphlfgyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfa
    nsgteavasalrlarattgrtlvvtfeghyhgwsetvlragktalhmegtrptdvvpgal
    gmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvippapgflqllrel
    tgrsgamlvfdevitgfrvarggaqerygvepdltvlsrvmgggfpvaafggrrhamrml
    asneahhagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrpv
    hinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalep
    wflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm4C (C:)
    tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgeiidlnmgygphlf
    gyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfansgteavasalr
    larattgrtlvvtfeghyhgwsetvlrarptdvvpgalgmipealahtvqlgwndpdalr
    elfardgdriaavivepvlanagvippapgflqllreltgrsgamlvfdevitgfrvarg
    gaqerygvepdltvlsrvmgggfpvaafggrrhamrmlasneahhagvyagnhaalravv
    amlgkirslpdlyerledtgqymedtvrevfatekrpvhinrvgtlmsvallkeprdlrq
    laalvdfprhrrlqtlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zm4D (D:)
    gshmgandadrptnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgei
    idlnmgygphlfgyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfa
    nsgteavasalrlarattgrtlvvtfeghyhgwsetvlragktalhmegtrptdvvpgal
    gmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvippapgflqllrel
    tgrsgamlvfdevitgfrvarggaqerygvepdltvlsrvmgggfpvaafggrrhamrml
    asneahhagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrpv
    hinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalep
    wflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm4D (D:)
    tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgeiidlnmgygphlf
    gyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfansgteavasalr
    larattgrtlvvtfeghyhgwsetvlrrptdvvpgalgmipealahtvqlgwndpdalre
    lfardgdriaavivepvlanagvippapgflqllreltgrsgamlvfdevitgfrvargg
    aqerygvepdltvlsrvmgggfpvaafggrrhamrmlasneahhagvyagnhaalravva
    mlgkirslpdlyerledtgqymedinrvgtlmsvallkgeprdlrqlavdfprhrrlqtl
    aqkeyfhpnalepwflstahvidkvag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zm4E (E:)
    gshmgandadrptnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgei
    idlnmgygphlfgyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfa
    nsgteavasalrlarattgrtlvvtfeghyhgwsetvlragktalhmegtrptdvvpgal
    gmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvippapgflqllrel
    tgrsgamlvfdevitgfrvarggaqerygvepdltvlsrvmgggfpvaafggrrhamrml
    asneahhagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrpv
    hinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalep
    wflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm4E (E:)
    tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgeiidlnmgygphlf
    gyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfansgteavasalr
    larattgrtlvvtfeghyhgwsetvlratrptdvvpgalgmipealahtvqlgwndpdal
    relfardgdriaavivepvlanagvippapgflqllreltgrsgamlvfdevitgfrvar
    ggaqerygvepdltvlsrvmgggfpvaafggrrhamrmlasneahhagvyagnhaalrav
    vamlgkirslpdlyerledtgqymedtvrevfatekrpvhinrvgtlmsvallkgsaeps
    aeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalepwflstahtrdvidkvagalqr
    slvgl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zm4F (F:)
    gshmgandadrptnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgei
    idlnmgygphlfgyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfa
    nsgteavasalrlarattgrtlvvtfeghyhgwsetvlragktalhmegtrptdvvpgal
    gmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvippapgflqllrel
    tgrsgamlvfdevitgfrvarggaqerygvepdltvlsrvmgggfpvaafggrrhamrml
    asneahhagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrpv
    hinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalep
    wflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm4F (F:)
    tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdvedgeiidlnmgygphlf
    gyadrevldavadqfakghmtglpheldaragaliaelvpgveqvrfansgteavasalr
    larattgrtlvvtfeghyhgwsetvlragrptdvvpgalgmipealahtvqlgwndpdal
    relfardgdriaavivepvlanagvippapgflqllreltgrsgamlvfdevitgfrvar
    ggaqerygvepdltvlsrvmgggfpvaafggrrhamrmlasneahhagvyagnhaalrav
    vamlgkirslpdlyerledtgqymedtvrevfatekrpvhinrvgtlmsvallkeprdlr
    qlaalvdfprhrrlqtlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvgl