PDB entry 4zm3

View 4zm3 on RCSB PDB site
Description: Crystal structure of PLP-Dependent 3-Aminobenzoate Synthase PctV wild-type
Class: transferase
Keywords: Pyridoxal 5-phosphate, Aminotransferase, TRANSFERASE
Deposited on 2015-05-02, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zm3a_
  • Chain 'B':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zm3b_
  • Chain 'C':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zm3c_
  • Chain 'D':
    Compound: aminotransferase
    Species: Streptomyces pactum [TaxId:68249]
    Gene: pctV, ptmT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zm3d_
  • Heterogens: PLP, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zm3A (A:)
    mgsshhhhhhssglvprgshmgandadrptnaesldgiksviaggvsssmraaavplplv
    vrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglpheldara
    galiaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlragkt
    alhmegtrptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlan
    agvippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgg
    gfpvaafggrrhamrmlasneahhagvyagnhaalravvamlgkirslpdlyerledtgq
    ymedtvrevfatekrpvhinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlq
    tlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm3A (A:)
    lplvvrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglphel
    daragaliaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlr
    agktatrptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlana
    gvippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmggg
    fpvaafggrrhamrmagvyagnhaalravvamlgkirslpdlyerledtgqymedtvrev
    fatekrpvhinrvgtlmsvallkgseprdlrqlaalvdfprhrrlqtlaqkegvyfhpna
    lepwflstahtrdvidkvagalqrslvgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zm3B (B:)
    mgsshhhhhhssglvprgshmgandadrptnaesldgiksviaggvsssmraaavplplv
    vrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglpheldara
    galiaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlragkt
    alhmegtrptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlan
    agvippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgg
    gfpvaafggrrhamrmlasneahhagvyagnhaalravvamlgkirslpdlyerledtgq
    ymedtvrevfatekrpvhinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlq
    tlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm3B (B:)
    lvvrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglphelda
    ragaliaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlrag
    trptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlanagvipp
    apgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgggfpvaa
    fggrrhamragvyagnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekr
    pvhinrvgtlmsvallkeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalepwflst
    ahtrdvidkvagalqrslvgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zm3C (C:)
    mgsshhhhhhssglvprgshmgandadrptnaesldgiksviaggvsssmraaavplplv
    vrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglpheldara
    galiaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlragkt
    alhmegtrptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlan
    agvippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgg
    gfpvaafggrrhamrmlasneahhagvyagnhaalravvamlgkirslpdlyerledtgq
    ymedtvrevfatekrpvhinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlq
    tlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm3C (C:)
    plvvrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglpheld
    aragaliaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlra
    gktalrptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlanag
    vippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgggf
    pvaafggrrhamrmgnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekr
    pvhinrvgtlmsvallkgsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnalepwf
    lstahtrdvidkvagalqrslvgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zm3D (D:)
    mgsshhhhhhssglvprgshmgandadrptnaesldgiksviaggvsssmraaavplplv
    vrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglpheldara
    galiaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlragkt
    alhmegtrptdvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlan
    agvippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgg
    gfpvaafggrrhamrmlasneahhagvyagnhaalravvamlgkirslpdlyerledtgq
    ymedtvrevfatekrpvhinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlq
    tlaqkegvyfhpnalepwflstahtrdvidkvagalqrslvglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zm3D (D:)
    lvvrsaggcllrdvedgeiidlnmgygphlfgyadrevldavadqfakghmtglphelda
    ragaliaelvpgveqvrfansgteavasalrlarattgrtlvvtfeghyhgwsetvlrag
    ktalhmedvvpgalgmipealahtvqlgwndpdalrelfardgdriaavivepvlanagv
    ippapgflqllreltgrsgamlvfdevitgfrvarggaqerygvepdltvlskvmgggfp
    vaafggrrhamrmgnhaalravvamlgkirslpdlyerledtgqymedtvrevfatekrp
    vhinrvgtlmsvallkgsaepsaeprdlrqlaalvdfprhrrlqtlaqkegvyfhpnale
    pwflstahtrdvidkvagalqrslvgl