PDB entry 4zlw

View 4zlw on RCSB PDB site
Description: Crystal structure of the PmFTN variant E130A soaked in iron (overnight)
Class: oxidoreductase
Keywords: ferritin, di-iron ferroxidase centre, 4-helix bundle, OXIDOREDUCTASE
Deposited on 2015-05-01, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwa_
  • Chain 'B':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwb_
  • Chain 'C':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwc_
  • Chain 'D':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwd_
  • Chain 'E':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6 (1-End)
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwe_
  • Chain 'F':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwf_
  • Chain 'G':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwg_
  • Chain 'H':
    Compound: Ferritin
    Species: Pseudo-nitzschia multiseries [TaxId:37319]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DMH6
      • engineered mutation (130)
    Domains in SCOPe 2.07: d4zlwh_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zlwA (A:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwA (A:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zlwB (B:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwB (B:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zlwC (C:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwC (C:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zlwD (D:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwD (D:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zlwE (E:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwE (E:)
    seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
    krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
    npfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zlwF (F:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwF (F:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zlwG (G:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwG (G:)
    elldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfankr
    nipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaflnp
    fhlqqvnaedkigsilakvtdenrtpgllrsldvvsf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4zlwH (H:)
    gseelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfa
    nkrnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaf
    lnpfhlqqvnaedkigsilakvtdenrtpgllrsldvvsflgpclfrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zlwH (H:)
    eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
    rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
    pfhlqqvnaedkigsilakvtdenrtpgllrsldvvs