PDB entry 4zl8

View 4zl8 on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa DsbA E82I: Crystal II
Class: oxidoreductase
Keywords: thioredoxin fold, OXIDOREDUCTASE
Deposited on 2015-05-01, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: dsbA, PA5489
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C2B2
      • engineered mutation (81)
    Domains in SCOPe 2.06: d4zl8a_
  • Heterogens: MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zl8A (A:)
    snaddytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhf
    vrlpalfggiwnvhgqmfltlismgvehdvhnavfeaihkehkklatpeemadflagkgv
    dkekflstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlklad
    yliekeraaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zl8A (A:)
    dytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhfvrlp
    alfggiwnvhgqmfltlismgvehdvhnavfeaihkehkklatpeemadflagkgvdkek
    flstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlkladylie
    keraaak