PDB entry 4zkb

View 4zkb on RCSB PDB site
Description: Orf chemokine binding protein complexed with CCL3
Class: Viral Protein/cytokine
Keywords: Complex, Orf chemokine binding protein, CCL3
Deposited on 2015-04-30, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemokine binding protein
    Species: Orf virus (strain NZ2) [TaxId:10259]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zkbb_
  • Heterogens: NAG, BMA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zkbB (B:)
    slaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlelsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zkbB (B:)
    taccfsytsrqipdyfetssqcskpgvifltrqvcadpseewvqkyvsd