PDB entry 4zk6

View 4zk6 on RCSB PDB site
Description: Crystallographic Capture of Quinolinate Synthase (NadA) from Pyrococcus horikoshii in its Substrates and Product-Bound States
Class: transferase
Keywords: quinolicnic acid, biosynthesis of nicotinamide adenine dinucleotide., TRANSFERASE
Deposited on 2015-04-29, released 2016-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinolinate synthase A
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: nadA, PH0013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zk6a_
  • Chain 'B':
    Compound: Quinolinate synthase A
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: nadA, PH0013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zk6b_
  • Heterogens: SF4, NTM, CL, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zk6A (A:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zk6A (A:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zk6B (B:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zk6B (B:)
    dlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdfm
    aetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakayad
    vtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftlddv
    erakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrkl
    ypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems