PDB entry 4zk2

View 4zk2 on RCSB PDB site
Description: Structure of Acetobacter aceti PurE-S57D
Class: isomerase
Keywords: acidophile, PurE, purine biosynthesis, ISOMERASE
Deposited on 2015-04-29, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zk2a_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zk2b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zk2A (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivdah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zk2A (A:)
    apvvgiimgsqsdwetmrhadallteleiphetlivdahrtpdrladyartaaerglnvi
    iagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasga
    knaallaasilalynpalaarletwralqtasvpnspi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zk2B (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivdah
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zk2B (B:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivdahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspit