PDB entry 4zju

View 4zju on RCSB PDB site
Description: Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD
Class: oxidoreductase
Keywords: SSGCID, NADH-dependent enoyl-ACP reductase, NAD, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2015-04-29, released 2015-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: fabI, IOMTU433_3282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zjua_
  • Heterogens: NAD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zjuA (A:)
    mahhhhhhmtqgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvde
    faeqfgsklvfpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdr
    dgfkiahdisaysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleag
    vrylasslgvdgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaa
    lflcspwasgitgeilyvdagfntvgmsqsmmdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zjuA (A:)
    qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
    fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
    aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
    dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
    itgeilyvdagfntvgmsqs