PDB entry 4zin

View 4zin on RCSB PDB site
Description: Genetically encoded Phenyl Azide Photochemistry Drive Positive and Negative Functional Modulation of a Red Fluorescent Protein
Class: fluorescent protein
Keywords: mCherry, Photoactivation, Photodeactivation, Coloration, Fluorescence, Microscopy, Phenyl Azide, Non-canonical amino acids, Optogenetics, Synchrotron, fluorescent protein
Deposited on 2015-04-28, released 2015-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MCherry fluorescent protein
    Species: Anaplasma marginale [TaxId:770]
    Gene: mCherry
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5DSL3 (0-218)
      • chromophore (60)
      • conflict (137)
    Domains in SCOPe 2.05: d4zina_
  • Chain 'B':
    Compound: MCherry fluorescent protein
    Species: Anaplasma marginale [TaxId:770]
    Gene: mCherry
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5DSL3 (0-218)
      • chromophore (60)
      • conflict (137)
    Domains in SCOPe 2.05: d4zinb_
  • Chain 'C':
    Compound: MCherry fluorescent protein
    Species: Anaplasma marginale [TaxId:770]
    Gene: mCherry
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5DSL3 (0-218)
      • chromophore (60)
      • conflict (137)
    Domains in SCOPe 2.05: d4zinc_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zinA (A:)
    aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf
    mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
    gtnfpsdgpvmqkktmgxeassermypedgalkgeikqrlklkdgghydaevkttykakk
    pvqlpgaynvniklditshnedytiveqyeraegrhstg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zinB (B:)
    aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf
    mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
    gtnfpsdgpvmqkktmgxeassermypedgalkgeikqrlklkdgghydaevkttykakk
    pvqlpgaynvniklditshnedytiveqyeraegrhstg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zinC (C:)
    aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf
    mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
    gtnfpsdgpvmqkktmgxeassermypedgalkgeikqrlklkdgghydaevkttykakk
    pvqlpgaynvniklditshnedytiveqyeraegrhstg