PDB entry 4zij

View 4zij on RCSB PDB site
Description: Crystal structure of E.Coli DsbA in complex with 2-(4-iodophenylsulfonamido) benzoic acid
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: DISULFIDE OXIDOREDUCTASE, REDOX PROTEIN, DSBA, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2015-04-28, released 2016-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:83333]
    Gene: dsbA, dsf, ppfA, b3860, JW3832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zija_
  • Chain 'B':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:83333]
    Gene: dsbA, dsf, ppfA, b3860, JW3832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zijb_
  • Heterogens: SFQ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zijA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zijB (B:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek