PDB entry 4zid

View 4zid on RCSB PDB site
Description: Dimeric Hydrogenobacter thermophilus cytochrome c552 obtained from Escherichia coli
Class: electron transport
Keywords: electron transport
Deposited on 2015-04-28, released 2016-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c-552
  Species: Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) [TaxId:608538]
  Gene: HTH_0988, Hydth_0984
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15452 (0-79)
  Domains in SCOPe 2.08: d4zida_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4zidA (A:)
  neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
  pqnvtdaeakqlaqwilsik