PDB entry 4zi3

View 4zi3 on RCSB PDB site
Description: BART-like domain of BARTL1/CCDC104 aa1-133 in complex with Arl3FL bound to GppNHp in P1 21 1
Class: hydrolase
Keywords: Arf-like GTPase, GTP-binding, BART-like domain, cilia, hydrolase
Deposited on 2015-04-27, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: ARL3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WUL7 (Start-181)
      • expression tag (182)
    Domains in SCOPe 2.07: d4zi3a1, d4zi3a2
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: ARL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zi3b_
  • Chain 'C':
    Compound: Cilia- and flagella-associated protein 36
    Species: Mus musculus [TaxId:10090]
    Gene: Cfap36, Ccdc104
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cilia- and flagella-associated protein 36
    Species: Mus musculus [TaxId:10090]
    Gene: Cfap36, Ccdc104
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zi3A (A:)
    mgllsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqg
    fklnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvp
    vlifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnak
    kklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zi3A (A:)
    llsilrklksapqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfkl
    nvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvli
    fankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zi3B (B:)
    mgllsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqg
    fklnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvp
    vlifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnak
    kklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zi3B (B:)
    llsilrklkevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwd
    iggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifank
    qdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.