PDB entry 4zho

View 4zho on RCSB PDB site
Description: The crystal structure of Arabidopsis ferredoxin 2 with 2Fe-2S cluster
Class: electron transport
Keywords: Ferredoxin 2Fe-2S cluster Electron Transfer Chloroplast, electron transport
Deposited on 2015-04-26, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FD2, PETF, PETF1, At1g60950, T7P1.9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16972 (Start-93)
      • expression tag (94-97)
    Domains in SCOPe 2.07: d4zhoa1, d4zhoa2
  • Chain 'B':
    Compound: Ferredoxin-2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FD2, PETF, PETF1, At1g60950, T7P1.9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16972 (Start-93)
      • expression tag (94-97)
    Domains in SCOPe 2.07: d4zhob1, d4zhob2
  • Heterogens: FES, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zhoA (A:)
    matykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqs
    dqsflddeqigegfvltcaayptsdvtiethkeeaimlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhoA (A:)
    atykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqsd
    qsflddeqigegfvltcaayptsdvtiethkeeaiml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zhoB (B:)
    matykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqs
    dqsflddeqigegfvltcaayptsdvtiethkeeaimlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhoB (B:)
    atykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqsd
    qsflddeqigegfvltcaayptsdvtiethkeeaiml