PDB entry 4zhc

View 4zhc on RCSB PDB site
Description: Siderocalin-mediated recognition and cellular uptake of actinides
Class: Metal Binding Protein/inhibitor
Keywords: Metal Binding Protein-inhibitor complex
Deposited on 2015-04-24, released 2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (Start-179)
      • engineered mutation (88)
    Domains in SCOPe 2.06: d4zhca_
  • Chain 'B':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered mutation (88)
    Domains in SCOPe 2.06: d4zhcb_
  • Chain 'C':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN2, HNL, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered mutation (88)
    Domains in SCOPe 2.06: d4zhcc_
  • Heterogens: TH, TC2, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zhcA (A:)
    gsqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyel
    kedksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqh
    amvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhcA (A:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zhcB (B:)
    gsqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyel
    kedksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqh
    amvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhcB (B:)
    dlipapplskvplqqnfqdnqfqgkwyvvglagnailreqkmyatiyelkedksynvtsv
    lfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsqn
    reyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zhcC (C:)
    gsqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyel
    kedksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqh
    amvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zhcC (C:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid