PDB entry 4zgk

View 4zgk on RCSB PDB site
Description: Structure of Mdm2 with low molecular weight inhibitor.
Class: ligase
Keywords: p53-Mdm2/MdmX interaction, inhibitor, ligase
Deposited on 2015-04-23, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4zgka1, d4zgka2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zgkb_
  • Heterogens: 4NX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zgkA (A:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zgkA (A:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zgkB (B:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zgkB (B:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
    sndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqe