PDB entry 4zg8

View 4zg8 on RCSB PDB site
Description: Crystal structure of Endoglucanase from Perinereis brevicirris
Class: hydrolase
Keywords: Cellulase, Endoglucanase, Polychaete, Annelid, hydrolase
Deposited on 2015-04-22, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Perinereis brevicirris [TaxId:6356]
    Gene: pnbEG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zg8a_
  • Chain 'B':
    Compound: endoglucanase
    Species: Perinereis brevicirris [TaxId:6356]
    Gene: pnbEG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zg8b_
  • Heterogens: CA, NA, BTB, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zg8A (A:)
    aqynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvk
    fglpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdgha
    dhaywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhar
    tiydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqg
    rpwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslr
    ysansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraasc
    pdmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgal
    agilql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zg8B (B:)
    aqynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvk
    fglpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdgha
    dhaywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhar
    tiydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqg
    rpwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslr
    ysansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraasc
    pdmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgal
    agilql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg8B (B:)
    qynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvkf
    glpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdghad
    haywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhart
    iydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqgr
    pwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslry
    sansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraascp
    dmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgala
    gilql