PDB entry 4zg5

View 4zg5 on RCSB PDB site
Description: Structural and functional insights into Survival endonuclease, an important virulence factor of Brucella abortus
Class: hydrolase
Keywords: Hydrolase
Deposited on 2015-04-22, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Brucella abortus S19 [TaxId:430066]
    Gene: surE, BAbS19_I08450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zg5a_
  • Chain 'C':
    Compound: 5'-nucleotidase sure
    Species: Brucella abortus S19 [TaxId:430066]
    Gene: surE, BAbS19_I08450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zg5c_
  • Chain 'D':
    Compound: 5'-nucleotidase sure
    Species: Brucella abortus S19 [TaxId:430066]
    Gene: surE, BAbS19_I08450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zg5d_
  • Chain 'G':
    Compound: 5'-nucleotidase sure
    Species: Brucella abortus S19 [TaxId:430066]
    Gene: surE, BAbS19_I08450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zg5g_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zg5A (A:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
    taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
    hkvraelgaalgvealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg5A (A:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrvtaq
    gklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldltahkv
    raelgaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zg5C (C:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
    taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
    hkvraelgaalgvealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg5C (C:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
    taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
    hkvraelga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zg5D (D:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
    taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
    hkvraelgaalgvealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg5D (D:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
    taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
    hkvraelgaalg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zg5G (G:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyeyagdrrivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrv
    taqgklshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldlta
    hkvraelgaalgvealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg5G (G:)
    mrilltnddgihaeglavleriarklsddvwvvapetdqsglahsltlleplrlrqidar
    hfalrgtptdcvimgvrhvlpgapdlvlsgvnsganmaddvtysgtvagamegtllgvra
    ialsqeyerivpwetaeahapeligrlmeagwpegvllnlnfpncapeevkgvrvtaqgk
    lshdarlderrdgrgfpyfwlhfgrgkapvaddsdiaairsgcismtplhldltahkvra
    elgaalg