PDB entry 4zg0

View 4zg0 on RCSB PDB site
Description: Crystal structure of Mouse Syndesmos protein
Class: hydrolase
Keywords: Nudix hydrolase, cytoplasmic protein, syndecan-4 cytoplasmic domain interactor, HYDROLASE
Deposited on 2015-04-22, released 2016-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein syndesmos
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT16L1, SDOS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zg0a_
  • Chain 'B':
    Compound: Protein syndesmos
    Species: Mus musculus [TaxId:10090]
    Gene: NUDT16L1, SDOS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zg0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zg0A (A:)
    gmstttvpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgl
    lgfpggfvdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltl
    eqlhaveisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkv
    lnmmpseklaealasatekqkkalekllppss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg0A (A:)
    elkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfv
    drrfwsledglnrvlgrlteadylsshltegphrvvahlyarqltleqlhaveisavhsr
    dhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpseklaeala
    satekqkkale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zg0B (B:)
    gmstttvpelkqisreeamrlgpgwshschamlyaanpgqlfgripmrfsvlmqmrfdgl
    lgfpggfvdrrfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltl
    eqlhaveisavhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkv
    lnmmpseklaealasatekqkkalekllppss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zg0B (B:)
    elkqisreeamrlgwshschamlyaanpgqlfgripmrfsvlmqmrfdgllgfpggfvdr
    rfwsledglnrvlglglgglrlteadylsshltegphrvvahlyarqltleqlhaveisa
    vhsrdhglevlglvrvplytqkdrvggfpnflsnafvstakyqllfalkvlnmmpsekla
    ealasatekqkkale