PDB entry 4zfm

View 4zfm on RCSB PDB site
Description: Structure of Gan1D-E170Q in complex with cellobiose-6-phosphate
Class: hydrolase
Keywords: Hydrolase, Cellobiose-6-phosphate, TIM barrel, catalytic mutant
Deposited on 2015-04-21, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d4zfma_
  • Chain 'B':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d4zfmb_
  • Chain 'C':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d4zfmc_
  • Chain 'D':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d4zfmd_
  • Heterogens: BG6, GOL, IMD, 0WK, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zfmA (A:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfmA (A:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilit
    englgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngy
    qkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zfmB (B:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfmB (B:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilit
    englgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngy
    qkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zfmC (C:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfmC (C:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilit
    englgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngy
    qkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zfmD (D:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfmD (D:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilit
    englgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngy
    qkrygfvyvnrddesekdlrrikkksfywyqrvietngael