PDB entry 4zfi

View 4zfi on RCSB PDB site
Description: Structure of Mdm2 with low molecular weight inhibitor
Class: ligase
Keywords: p53-binding protein Mdm2, Oncoprotein Mdm2, Double minute 2 protein, Hdm2, small molecule inhibitor, ligase
Deposited on 2015-04-21, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zfia_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4zfib_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zfic_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zfid_
  • Heterogens: 4NJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zfiA (A:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfiA (A:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
    sndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zfiB (B:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zfiC (C:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfiC (C:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
    sndllgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zfiD (D:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zfiD (D:)
    ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
    ndllgdlfgvpsfsvkehrkiytmiyrnlvvvn