PDB entry 4zev

View 4zev on RCSB PDB site
Description: Crystal structure of PfHAD1 in complex with mannose-6-phosphate
Class: unknown function
Keywords: C2 HAD, sugar phosphatase, haloacid-dehalogenase, mannose-6-phosphate, UNKNOWN FUNCTION
Deposited on 2015-04-20, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PfHAD1
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF10_0325
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJ74 (8-295)
      • expression tag (6-7)
      • engineered mutation (34)
  • Chain 'B':
    Compound: PfHAD1
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF10_0325
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJ74
      • engineered mutation (34)
    Domains in SCOPe 2.07: d4zevb_
  • Heterogens: MG, M6P, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zevB (B:)
    mahhhhhhmheivdkngkkvqknnlndeikiiftaldgtllnsenkvseqnlesliraqe
    kgikvviatgrsifsvenvigehvkknrisllpgiymngcvtfdekgsrvidrimnndlk
    meihefskqiniskyaiwfclektycfeindcireymevealnpdviednmlegltvykv
    lfslpenilentlklcrekfshrinvantfqsyvelfhqhtnkfegvkeickyynislnn
    alamgdgendiemlsglthsvgvhnasekvknsaayvgpsnnehaishvlktfcdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zevB (B:)
    ndeikiiftaldgtllnsenkvseqnlesliraqekgikvviatgrsifsvenvigehvk
    knrisllpgiymngcvtfdekgsrvidrimnndlkmeihefskqiniskyaiwfclekty
    cfeindcireymevealnpdviednmlegltvykvlfslpenilentlklcrekfshrin
    vantfqsyvelfhqhtnkfegvkeickyynislnnalamgdgendiemlsglthsvgvhn
    asekvknsaayvgpsnnehaishvlktfcd