PDB entry 4zdf

View 4zdf on RCSB PDB site
Description: Crystal structure of yeast enoyl-CoA isomerase helix-10 deletion (ScECI2-H10) mutant
Class: isomerase
Keywords: Crotonase, isomerase, enoyl-CoA isomerase, beta-oxidation
Deposited on 2015-04-17, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.07: d4zdfa_
  • Chain 'B':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.07: d4zdfb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zdfA (A:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdfA (A:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaal
    valcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimc
    engfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansv
    evneslkywvdgeplkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zdfB (B:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdfB (B:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalval
    cdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimceng
    fisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevn
    eslkywvdgeplkr