PDB entry 4zde

View 4zde on RCSB PDB site
Description: Crystal structure of yeast D3,D2-enoyl-CoA isomerase F268A mutant
Class: isomerase
Keywords: Crotonase, isomerase, beta-oxidation, enoyl-CoA isomerase
Deposited on 2015-04-17, released 2015-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
      • engineered mutation (287)
    Domains in SCOPe 2.06: d4zdea_
  • Chain 'B':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
      • engineered mutation (287)
    Domains in SCOPe 2.06: d4zdeb_
  • Chain 'C':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
      • engineered mutation (287)
    Domains in SCOPe 2.06: d4zdec_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zdeA (A:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrarqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdeA (A:)
    qeirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqss
    grffssgadfkgkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalva
    lcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimcen
    gfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvev
    neslkywvdgeplkrarql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zdeB (B:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrarqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdeB (B:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalval
    cdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimceng
    fisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevn
    eslkywvdgeplkrarq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zdeC (C:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrarqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdeC (C:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalval
    cdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimceng
    fisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevn
    eslkywvdgeplkrar