PDB entry 4zdd

View 4zdd on RCSB PDB site
Description: Structure of yeast D3,D2-enoyl-CoA isomerase bound to sulphate ion
Class: isomerase
Keywords: Crotonase, isomerase, enoyl-CoA isomerase, beta-oxidation
Deposited on 2015-04-17, released 2015-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.08: d4zdda_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zddA (A:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zddA (A:)
    qnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrff
    ssgadfktskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalvalcdivysind
    kvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmp
    ssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevneslkywvdg
    eplkrfr