PDB entry 4zdc

View 4zdc on RCSB PDB site
Description: Yeast enoyl-CoA isomerase complexed with octanoyl-CoA
Class: isomerase
Keywords: Crotonase, isomerase, octanoyl-CoA, beta-oxidation
Deposited on 2015-04-17, released 2015-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.06: d4zdca_
  • Chain 'B':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.06: d4zdcb_
  • Chain 'C':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.06: d4zdcc_
  • Heterogens: SO4, CO8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zdcA (A:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdcA (A:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
    iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
    fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
    fnkansvevneslkywvdgeplkrfrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zdcB (B:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdcB (B:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakaqkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsa
    alvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydi
    mcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkan
    svevneslkywvdgeplkrfrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zdcC (C:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdcC (C:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakaqkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsa
    alvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydi
    mcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkan
    svevneslkywvdgeplkrfrq