PDB entry 4zdb

View 4zdb on RCSB PDB site
Description: Yeast enoyl-CoA isomerase (ScECI2) complexed with acetoacetyl-CoA
Class: isomerase
Keywords: Crotonase, Isomerase, acetoacetyl-CoA, beta-oxidation
Deposited on 2015-04-17, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.07: d4zdba_
  • Chain 'B':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.07: d4zdbb_
  • Chain 'C':
    Compound: 3,2-trans-enoyl-CoA isomerase
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ECI1, YLR284C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05871
      • conflict (44)
    Domains in SCOPe 2.07: d4zdbc_
  • Heterogens: SO4, CAA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zdbA (A:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdbA (A:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
    iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
    fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
    fnkansvevneslkywvdgeplkrfrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zdbB (B:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdbB (B:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakakypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaa
    lvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydim
    cengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkans
    vevneslkywvdgeplkrfrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zdbC (C:)
    mgsshhhhhhssglvprgshmsqeirqnekisyriegpffiihlinpdnlnalegedyiy
    lgelleladrnrdvyftiiqssgrffssgadfkgiakaqgddtnkypsetskwvsnfvar
    nvyvtdafikhskvlicclngpaiglsaalvalcdivysindkvyllypfanlglitegg
    ttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmpssnaeafnakvleelrek
    vkglylpsclgmkkllksnhidafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zdbC (C:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakaqgkypsetskwvsnfvarnvyvtdafikhskvlicclngpaigls
    aalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkyd
    imcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnka
    nsvevneslkywvdgeplkrfrq