PDB entry 4zd6

View 4zd6 on RCSB PDB site
Description: Halohydrin hydrogen-halide-lyase, HheB
Class: lyase
Keywords: Lyase
Deposited on 2015-04-17, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Halohydrin epoxidase B
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zd6a_
  • Chain 'B':
    Compound: Halohydrin epoxidase B
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zd6b_
  • Chain 'C':
    Compound: Halohydrin epoxidase B
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zd6c_
  • Chain 'D':
    Compound: Halohydrin epoxidase B
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zd6d_
  • Chain 'E':
    Compound: Halohydrin epoxidase B
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zd6e_
  • Chain 'F':
    Compound: Halohydrin epoxidase B
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zd6f_
  • Heterogens: CL, MES, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zd6A (A:)
    mkngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidv
    lvanfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaa
    amryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdef
    kedmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zd6A (A:)
    ngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlv
    anfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaam
    ryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefke
    dmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zd6B (B:)
    mkngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidv
    lvanfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaa
    amryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdef
    kedmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zd6B (B:)
    ngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlv
    anfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaam
    ryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefke
    dmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zd6C (C:)
    mkngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidv
    lvanfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaa
    amryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdef
    kedmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zd6C (C:)
    grlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlva
    nfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaamr
    yqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefked
    marrvplgrlataredallalflasdesdfivgksiefdggwat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zd6D (D:)
    mkngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidv
    lvanfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaa
    amryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdef
    kedmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zd6D (D:)
    grlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlva
    nfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaamr
    yqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefked
    marrvplgrlataredallalflasdesdfivgksiefdggwat
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zd6E (E:)
    mkngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidv
    lvanfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaa
    amryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdef
    kedmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zd6E (E:)
    grlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlva
    nfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaamr
    yqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefked
    marrvplgrlataredallalflasdesdfivgksiefdggwat
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zd6F (F:)
    mkngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidv
    lvanfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaa
    amryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdef
    kedmarrvplgrlataredallalflasdesdfivgksiefdggwat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zd6F (F:)
    ngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlv
    anfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaam
    ryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefke
    dmarrvplgrlataredallalflasdesdfivgksiefdggwat