PDB entry 4zcw

View 4zcw on RCSB PDB site
Description: Structure of Human Enolase 2 in complex with SF2312
Class: lyase/lyase inhibitor
Keywords: enolase gamma, glycolysis, neuron specific enolase, inhibitor, LYASE-LYASE INHIBITOR complex
Deposited on 2015-04-16, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcwa1, d4zcwa2
  • Chain 'B':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcwb1, d4zcwb2
  • Heterogens: 4NG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zcwA (A:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcwA (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zcwB (B:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcwB (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl