PDB entry 4zct

View 4zct on RCSB PDB site
Description: Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase
Class: transferase
Keywords: transferase, malaria, cytidylyltransferase, phosphatidylcholine
Deposited on 2015-04-16, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholinephosphate cytidylyltransferase
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: ctP, MAL13P1.86
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zctA (A:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zctA (A:)
    knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
    tlkhirwvdeiispcpwvvtpeflekykidyvahdddiyawlkragkfkatqrtegvstt
    dlivrilknyedy