PDB entry 4zcs

View 4zcs on RCSB PDB site
Description: Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase in complex with CDP-choline
Class: transferase
Keywords: enzyme, malaria, cytidylyltransferase, phosphatidylcholine, transferase
Deposited on 2015-04-16, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Choline-phosphate cytidylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1316600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcsa_
  • Chain 'B':
    Compound: Choline-phosphate cytidylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1316600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcsb_
  • Chain 'C':
    Compound: Choline-phosphate cytidylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1316600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcsc_
  • Chain 'D':
    Compound: Choline-phosphate cytidylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1316600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcsd_
  • Chain 'E':
    Compound: Choline-phosphate cytidylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1316600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcse_
  • Chain 'F':
    Compound: Choline-phosphate cytidylyltransferase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_1316600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zcsf_
  • Heterogens: CDC, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zcsA (A:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcsA (A:)
    knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
    tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
    qrtegvsttdlivrilknyed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zcsB (B:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcsB (B:)
    knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
    tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
    qrtegvsttdlivrilknye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zcsC (C:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcsC (C:)
    knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
    tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
    qrtegvsttdlivrilk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zcsD (D:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcsD (D:)
    knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
    tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
    qrtegvsttdlivrilkny
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zcsE (E:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcsE (E:)
    knvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleerte
    tlkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkat
    qrtegvsttdlivrilknyed
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zcsF (F:)
    ghmavpdddddddnsndeseyessqmdseknkgsiknsknvviyadgvydmlhlghmkql
    eqakklfenttlivgvtsdnetklfkgqvvqtleertetlkhirwvdeiispcpwvvtpe
    flekykidyvahddipyannqkediyawlkragkfkatqrtegvsttdlivrilknyedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcsF (F:)
    nvviyadgvydmlhlghmkqleqakklfenttlivgvtsdnetklfkgqvvqtleertet
    lkhirwvdeiispcpwvvtpeflekykidyvahddipyannqkediyawlkragkfkatq
    rtegvsttdlivrilknyedy