PDB entry 4zcj

View 4zcj on RCSB PDB site
Description: Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA1 Cys30, HA2 Cys47 mutant
Class: viral protein
Keywords: influenza, hemagglutinin, glycoprotein, VIRAL PROTEIN
Deposited on 2015-04-16, released 2015-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d4zcja1, d4zcja2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • engineered mutation (46)
      • conflict (122)
    Domains in SCOPe 2.07: d4zcjb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d4zcjc1, d4zcjc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • engineered mutation (46)
      • conflict (122)
    Domains in SCOPe 2.07: d4zcjd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d4zcje1, d4zcje2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • engineered mutation (46)
      • conflict (122)
    Domains in SCOPe 2.07: d4zcjf_
  • Heterogens: NAG, BMA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zcjA (A:)
    adpgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcjA (A:)
    pgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zcjB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcjB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zcjC (C:)
    adpgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcjC (C:)
    pgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zcjD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcjD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zcjE (E:)
    adpgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcjE (E:)
    pgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zcjF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zcjF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf