PDB entry 4zba

View 4zba on RCSB PDB site
Description: Crystal structure of the glutathione transferase URE2P8 from Phanerochaete chrysosporium with oxidized glutathione.
Class: transferase
Keywords: glutathione transferase, gst fold, oxydized glutathione, transferase
Deposited on 2015-04-14, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PcUre2p8
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZBA (Start-222)
    Domains in SCOPe 2.07: d4zbaa1, d4zbaa2
  • Chain 'B':
    Compound: PcUre2p8
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZBA (Start-222)
    Domains in SCOPe 2.07: d4zbab1, d4zbab2
  • Chain 'C':
    Compound: PcUre2p8
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZBA (Start-222)
    Domains in SCOPe 2.07: d4zbac1, d4zbac2
  • Chain 'D':
    Compound: PcUre2p8
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZBA (Start-222)
    Domains in SCOPe 2.07: d4zbad1, d4zbad2
  • Heterogens: GDS, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zbaA (A:)
    mashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtp
    alidhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfg
    qlvwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmi
    vhfldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zbaA (A:)
    ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa
    lidhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfgq
    lvwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmiv
    hfldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zbaB (B:)
    mashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtp
    alidhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfg
    qlvwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmi
    vhfldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zbaB (B:)
    shdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpal
    idhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfgql
    vwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmivh
    fldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zbaC (C:)
    mashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtp
    alidhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfg
    qlvwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmi
    vhfldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zbaC (C:)
    ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa
    lidhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfgq
    lvwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmiv
    hfldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zbaD (D:)
    mashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtp
    alidhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfg
    qlvwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmi
    vhfldnfdfekefpataawhykmlkrptikrpwderrklmsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zbaD (D:)
    shdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpal
    idhgnsdfviwesnamvqyvadkydterkismapgtddfyiqlqwqyfqgtgqgpyfgql
    vwftlyheekipsavtrykeealrvfsvlervlsnqewlvggkmtiadisfvswndmivh
    fldnfdfekefpataawhykmlkrptikrpwderrklmsrq