PDB entry 4zau

View 4zau on RCSB PDB site
Description: AZD9291 complex with wild type EGFR
Class: transferase/transferase inhibitor
Keywords: transferase, kinase domain, transferase-transferase inhibitor complex
Deposited on 2015-04-14, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zaua_
  • Heterogens: YY3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zauA (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zauA (A:)
    apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikenkeildeayvm
    asvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmn
    yledrrlvhrdlaarnvlvktpqhvkitdfglakllekeyhaekvpikwmalesilhriy
    thqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcw
    midadsrpkfreliiefskmardpqrylviqgdddvvdadeyl