PDB entry 4zas

View 4zas on RCSB PDB site
Description: Crystal structure of sugar aminotransferase CalS13 from Micromonospora echinospora
Class: transferase
Keywords: sugar aminotransferase, Structural Genomics, PSI-Biology, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, TRANSFERASE
Deposited on 2015-04-14, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalS13
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calS13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zasa_
  • Chain 'B':
    Compound: CalS13
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calS13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zasb_
  • Chain 'C':
    Compound: CalS13
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calS13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zasc_
  • Chain 'D':
    Compound: CalS13
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calS13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zasd_
  • Chain 'E':
    Compound: CalS13
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calS13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zase_
  • Chain 'F':
    Compound: CalS13
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calS13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zasf_
  • Heterogens: SO4, T46, TYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zasA (A:)
    mgsshhhhhhssglvprgshmatsergvmiplskvamspdvstrvsavlssgrlehgptv
    aeyeaavgsrignprvvsvncgtaglhlalslaarpgagesehdgpgevlttpltfegtn
    wpilanglrirwvdvdpatlnmdlddlaakispatraivvvhwlgypvdlnrlravvdra
    tagydrrplvvedcaqawgatyrgaplgthgnvcvystgaikilttgsggfvvlpdddly
    drlrlrrwlgierasdritgdydvaewgyrfilneiggaiglsnlervdellrrhrenaa
    fydkelagidgveqteraddrepafwmyplkvrdrpafmrrlldagiatsvvsrrndahs
    cvasarttlpgldrvadrvvhipvgwwlteddrshvvetiksgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zasA (A:)
    miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
    alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
    raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
    ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
    iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
    pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
    vvetiksgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zasB (B:)
    mgsshhhhhhssglvprgshmatsergvmiplskvamspdvstrvsavlssgrlehgptv
    aeyeaavgsrignprvvsvncgtaglhlalslaarpgagesehdgpgevlttpltfegtn
    wpilanglrirwvdvdpatlnmdlddlaakispatraivvvhwlgypvdlnrlravvdra
    tagydrrplvvedcaqawgatyrgaplgthgnvcvystgaikilttgsggfvvlpdddly
    drlrlrrwlgierasdritgdydvaewgyrfilneiggaiglsnlervdellrrhrenaa
    fydkelagidgveqteraddrepafwmyplkvrdrpafmrrlldagiatsvvsrrndahs
    cvasarttlpgldrvadrvvhipvgwwlteddrshvvetiksgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zasB (B:)
    miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
    alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
    raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
    ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
    iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
    pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
    vvetiksgw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zasC (C:)
    mgsshhhhhhssglvprgshmatsergvmiplskvamspdvstrvsavlssgrlehgptv
    aeyeaavgsrignprvvsvncgtaglhlalslaarpgagesehdgpgevlttpltfegtn
    wpilanglrirwvdvdpatlnmdlddlaakispatraivvvhwlgypvdlnrlravvdra
    tagydrrplvvedcaqawgatyrgaplgthgnvcvystgaikilttgsggfvvlpdddly
    drlrlrrwlgierasdritgdydvaewgyrfilneiggaiglsnlervdellrrhrenaa
    fydkelagidgveqteraddrepafwmyplkvrdrpafmrrlldagiatsvvsrrndahs
    cvasarttlpgldrvadrvvhipvgwwlteddrshvvetiksgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zasC (C:)
    miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
    alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
    raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
    ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
    iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
    pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
    vvetiksgw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zasD (D:)
    mgsshhhhhhssglvprgshmatsergvmiplskvamspdvstrvsavlssgrlehgptv
    aeyeaavgsrignprvvsvncgtaglhlalslaarpgagesehdgpgevlttpltfegtn
    wpilanglrirwvdvdpatlnmdlddlaakispatraivvvhwlgypvdlnrlravvdra
    tagydrrplvvedcaqawgatyrgaplgthgnvcvystgaikilttgsggfvvlpdddly
    drlrlrrwlgierasdritgdydvaewgyrfilneiggaiglsnlervdellrrhrenaa
    fydkelagidgveqteraddrepafwmyplkvrdrpafmrrlldagiatsvvsrrndahs
    cvasarttlpgldrvadrvvhipvgwwlteddrshvvetiksgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zasD (D:)
    miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
    alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
    raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
    ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
    iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
    pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
    vvetiksgw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zasE (E:)
    mgsshhhhhhssglvprgshmatsergvmiplskvamspdvstrvsavlssgrlehgptv
    aeyeaavgsrignprvvsvncgtaglhlalslaarpgagesehdgpgevlttpltfegtn
    wpilanglrirwvdvdpatlnmdlddlaakispatraivvvhwlgypvdlnrlravvdra
    tagydrrplvvedcaqawgatyrgaplgthgnvcvystgaikilttgsggfvvlpdddly
    drlrlrrwlgierasdritgdydvaewgyrfilneiggaiglsnlervdellrrhrenaa
    fydkelagidgveqteraddrepafwmyplkvrdrpafmrrlldagiatsvvsrrndahs
    cvasarttlpgldrvadrvvhipvgwwlteddrshvvetiksgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zasE (E:)
    miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
    alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
    raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
    ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
    iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
    pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
    vvetiksgw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zasF (F:)
    mgsshhhhhhssglvprgshmatsergvmiplskvamspdvstrvsavlssgrlehgptv
    aeyeaavgsrignprvvsvncgtaglhlalslaarpgagesehdgpgevlttpltfegtn
    wpilanglrirwvdvdpatlnmdlddlaakispatraivvvhwlgypvdlnrlravvdra
    tagydrrplvvedcaqawgatyrgaplgthgnvcvystgaikilttgsggfvvlpdddly
    drlrlrrwlgierasdritgdydvaewgyrfilneiggaiglsnlervdellrrhrenaa
    fydkelagidgveqteraddrepafwmyplkvrdrpafmrrlldagiatsvvsrrndahs
    cvasarttlpgldrvadrvvhipvgwwlteddrshvvetiksgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zasF (F:)
    miplskvamspdvstrvsavlssgrlehgptvaeyeaavgsrignprvvsvncgtaglhl
    alslaarpgapgevlttpltfegtnwpilanglrirwvdvdpatlnmdlddlaakispat
    raivvvhwlgypvdlnrlravvdratagydrrplvvedcaqawgatyrgaplgthgnvcv
    ystgaikilttgsggfvvlpdddlydrlrlrrwlgierasdritgdydvaewgyrfilne
    iggaiglsnlervdellrrhrenaafydkelagidgveqteraddrepafwmyplkvrdr
    pafmrrlldagiatsvvsrrndahscvasarttlpgldrvadrvvhipvgwwlteddrsh
    vvetiksgw