PDB entry 4zah

View 4zah on RCSB PDB site
Description: Crystal structure of sugar aminotransferase WecE with External Aldimine VII from Escherichia coli K-12
Class: transferase
Keywords: sugar aminotransferase, Structural Genomics, PSI-Biology, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, TRANSFERASE
Deposited on 2015-04-13, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zaha1, d4zaha2
  • Chain 'B':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahb1, d4zahb2
  • Chain 'C':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahc1, d4zahc2
  • Chain 'D':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahd1, d4zahd2
  • Chain 'E':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahe1, d4zahe2
  • Chain 'F':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahf1, d4zahf2
  • Chain 'G':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahg1, d4zahg2
  • Chain 'H':
    Compound: dTDP-4-amino-4,6-dideoxygalactose transaminase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rffA, wecE, yifI, b3791, JW3765
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27833 (20-395)
      • expression tag (19)
    Domains in SCOPe 2.07: d4zahh1, d4zahh2
  • Heterogens: T5K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zahA (A:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahA (A:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrsqkytwrdigssylmsdlqaaylwaq
    leaadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsal
    inflkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrt
    viatllnyfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zahB (B:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahB (B:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrsqkytwrdigssylmsdlqaaylwaq
    leaadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsal
    inflkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrt
    viatllnyfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zahC (C:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahC (C:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrsytwrdigssylmsdlqaaylwaqle
    aadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalin
    flkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtvi
    atllnyfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zahD (D:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahD (D:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrskytwrdigssylmsdlqaaylwaql
    eaadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsali
    nflkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtv
    iatllnyfs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4zahE (E:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahE (E:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrytwrdigssylmsdlqaaylwaqlea
    adrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinf
    lkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtvia
    tllnyfs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4zahF (F:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahF (F:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrytwrdigssylmsdlqaaylwaqlea
    adrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinf
    lkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtvia
    tllnyfs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4zahG (G:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahG (G:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrytwrdigssylmsdlqaaylwaqlea
    adrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinf
    lkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtvia
    tllnyfs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4zahH (H:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zahH (H:)
    hmipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasl
    emaallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdk
    trvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhe
    tknytaggeggatlindkalieraeiirekgtnrsytwrdigssylmsdlqaaylwaqle
    aadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalin
    flkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtvi
    atllnyfs