PDB entry 4za0

View 4za0 on RCSB PDB site
Description: Structure of Human Enolase 2 in complex with Phosphonoacetohydroxamate
Class: lyase/lyase inhibitor
Keywords: enolase gamma, glycolysis, neuron specific enolase, carbohydrate metabolism, LYASE-LYASE INHIBITOR complex
Deposited on 2015-04-13, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4za0a1, d4za0a2
  • Chain 'B':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4za0b1, d4za0b2
  • Heterogens: MG, PAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4za0A (A:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4za0A (A:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4za0B (B:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4za0B (B:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnps