PDB entry 4z9v

View 4z9v on RCSB PDB site
Description: TCTP contains a BH3-like domain, which instead of inhibiting, activates Bcl-xL
Class: apoptosis
Keywords: TCTP, apoptose, BH3, apoptosis
Deposited on 2015-04-12, released 2016-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bcl-2-like protein 1,APOPTOSIS REGULATOR BCL-XL
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL2L1, BCL2L, BCLX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07817 (1-26)
    • expression tag (0)
  • Uniprot Q07817 (27-152)
  Domains in SCOPe 2.08: d4z9va1, d4z9va2
• Chain 'B':
  Compound: Bcl-2-like protein 1,APOPTOSIS REGULATOR BCL-XL
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL2L1, BCL2L, BCLX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07817 (1-26)
  • Uniprot Q07817 (27-End)
  Domains in SCOPe 2.08: d4z9vb_
• Chain 'C':
  Compound: Translationally-controlled tumor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TPT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13693
• Chain 'D':
  Compound: Translationally-controlled tumor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TPT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13693
• Chain 'E':
  Compound: Translationally-controlled tumor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TPT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13693 (0-20)
• Chain 'F':
  Compound: Translationally-controlled tumor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TPT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13693 (0-End)
• Chain 'G':
  Compound: Translationally-controlled tumor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TPT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13693 (0-20)
• Chain 'H':
  Compound: Translationally-controlled tumor protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TPT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13693 (0-20)
• Heterogens: BCT, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4z9vA (A:)
  hmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhit
  pgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatyln
  dhlepwiqenggwdtfvelygnnaaaesrkgqe
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4z9vB (B:)
  hmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhit
  pgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatyln
  dhlepwiqenggwdtfvelygnnaaaesrkgqe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4z9vB (B:)
  msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
  gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
  hlepwiqenggwdtfvelygnnaaaesrkgq
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.