PDB entry 4z9m

View 4z9m on RCSB PDB site
Description: Crystal structure of human sarcomeric mitochondrial creatine kinase
Class: transferase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2015-04-10, released 2015-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9ma1, d4z9ma2
  • Chain 'B':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9mb1, d4z9mb2
  • Chain 'C':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9mc1, d4z9mc2
  • Chain 'D':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9md1, d4z9md2
  • Chain 'E':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9me1, d4z9me2
  • Chain 'F':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9mf1, d4z9mf2
  • Chain 'G':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9mg1, d4z9mg2
  • Chain 'H':
    Compound: Creatine kinase S-type, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CKMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4z9mh1, d4z9mh2
  • Heterogens: ADP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z9mA (A:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mA (A:)
    rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfikt
    vgmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgqfdehyvlssrv
    rtgrsirglslppactraerrevenvaitaleglkgdlagryyklsemteqdqqrliddh
    flfdkpvsplltcagmardwpdargiwhnydktfliwineedhtrvismekggnmkrvfe
    rfcrglkeverliqergwefmwnerlgyiltcpsnlgtglragvhvripklskdprfski
    lenlrlqkrgtggvdtaavadvydisnidrigrsevelvqividgvnylvdc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z9mB (B:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mB (B:)
    reqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpikt
    vgmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskqqfssrvrtgrsirgl
    slppactraerrevenvaitaleglkgdlagryyklsemteqdqqrliddhflfdkpvsp
    lltcagmardwpdargiwhnydktfliwineedhtrvismekggnmkrvferfcrglkev
    erliqergwefmwnerlgyiltcpsnlgtglragvhsnidrigrsevelvqividgvnyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4z9mC (C:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mC (C:)
    reqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghp
    fiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgqfdehyvl
    ssrvrtgrsirglslppactraerrevenvaitaleglkgdlagryyklsemteqdqqrl
    iddhflfdkpvsplltcagmardwpdargiwhnydktfliwineedhtrvismekggnmk
    rvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtglragvhvripklskdpr
    fskilenlrlqkrgtggvdtaavadvydisnidrigrsevelvqividgvnylvdcekkl
    ergqdikvppplpqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4z9mD (D:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mD (D:)
    reqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghp
    fiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgqfdehyvl
    ssrvrtgrsirglslppactraerrevenvaitaleglkgdlagryyklsemteqdqqrl
    iddhflfdkpvsplltcagmardwpdargiwhnydktfliwineedhtrvismekggnmk
    rvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtglragvhvripklskdpr
    fskilenlrlqkrgtggvdtaavadvydisnidrigrsevelvqividgvnylvdcekkl
    ergqdikvppplpqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z9mE (E:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mE (E:)
    lfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfiktv
    gmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgqfdehyvlssrvr
    tgrsirglslppactraerrevenvaitaleglkgdlagryyklsemteqdqqrliddhf
    lfdkpvsplltcagmardwpdargiwhnydktfliwineedhtrvismekggnmkrvfer
    fcrglkeverliqergwefmwnerlgyiltcpsnlgtglragvhvripklskdprfskil
    enlrlqkrgtggvdtaavadvydisnidrigrsevelvqividgvnylvdcekklergqd
    ikvppplpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4z9mF (F:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mF (F:)
    rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfikt
    vgmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgqfdehyvlssrv
    rtgrsirglslppactraerrevenvaitaleglkgdlagryyklsemteqdqqrliddh
    flfdkpvsplltcagmardwpdargiwhnydktfliwineedhtrvismekggnmkrvfe
    rfcrglkeverliqergwefmwnerlgyiltcpsnlgtglragvhvripklskdprfski
    lenlrlqkrgtggvdtaavadvydisnidrigrsevelvqividgvnylvdcekklergq
    dikvppplp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4z9mG (G:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mG (G:)
    reqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpktv
    gmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgssrvrtgrsirgl
    slppactraerrevenvaitaleglkgdlagryyklsemteqdqqrliddhflfdkpvsp
    lltcagmardwpdargiwhnydktfliwineedhtrvismekggnmkrvferfcrglkev
    erliqergwefmwnerlgyiltcpsnlgtglragvhrlqkrgggvdtadisnidrigrse
    velvqividgvlp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4z9mH (H:)
    gsttgyllnrqkvcaevreqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpng
    ytldqciqtgvdnpghpfiktvgmvagdeesyevfadlfdpviklrhngydprvmkhttd
    ldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitaleglkgdla
    gryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydktfliwin
    eedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnlgtg
    lragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrigrsevelv
    qividgvnylvdcekklergqdikvppplpqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9mH (H:)
    rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfikt
    vgmvagdeesyevfadlfdpviklrhngydprvmkhttdldaskitqgqfdehyvlssrv
    rtgrsirglslppactraerrevenvaitaleglkgdlagryyklsemteqdqqrliddh
    flfdkpvsplltcagmardwpdargiwhnydktfliwineedhtrvismekggnmkrvfe
    rfcrglkeverliqergwefmwnerlgyiltcpsnlgtglragvhvripklskdprfski
    lenlrlqkrgtggvdtaavadvydisnidrigrsevelvqividgvnylvdcekklikvp
    pplpq