PDB entry 4z9f

View 4z9f on RCSB PDB site
Description: Halohydrin hydrogen-halide-lyase, HheA
Class: lyase
Keywords: Lyase
Deposited on 2015-04-10, released 2015-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (Start-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fa_
  • Chain 'B':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (Start-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fb_
  • Chain 'C':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (0-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fc_
  • Chain 'D':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (0-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fd_
  • Chain 'E':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (Start-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fe_
  • Chain 'F':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (0-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9ff_
  • Chain 'G':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (0-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fg_
  • Chain 'H':
    Compound: Halohydrin epoxidase A
    Species: Corynebacterium sp. [TaxId:1720]
    Gene: hheA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46346 (0-243)
      • engineered mutation (33)
    Domains in SCOPe 2.05: d4z9fh_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z9fA (A:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9fA (A:)
    kialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkper
    lvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiapl
    raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
    nptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftgg
    ylp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4z9fB (B:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9fB (B:)
    kialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkper
    lvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiapl
    raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
    nptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftgg
    ylp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z9fC (C:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z9fD (D:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4z9fE (E:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z9fE (E:)
    kialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkper
    lvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiapl
    raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
    nptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftgg
    ylp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z9fF (F:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z9fG (G:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4z9fH (H:)
    mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
    rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
    lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
    nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
    gylp