PDB entry 4z6b

View 4z6b on RCSB PDB site
Description: YopH W354H Yersinia enterocolitica PTPase in the apo form
Class: hydrolase
Keywords: phosphatase, Yersinia, PTP, HYDROLASE
Deposited on 2015-04-04, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase yopH
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered mutation (72)
      • engineered mutation (191)
    Domains in SCOPe 2.08: d4z6ba_
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4z6bA (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnhpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4z6bA (A:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnhpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns